PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.E01006.1.p
Common NameEUGRSUZ_E01006
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family MIKC_MADS
Protein Properties Length: 209aa    MW: 24185.4 Da    PI: 8.6114
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.E01006.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF94.83.9e-30959151
                      S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
            SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                      krien+ nrqvt+skRrng++KKA+E+SvLCda+v+viif+s+gk++ey+s
  Eucgr.E01006.1.p  9 KRIENSNNRQVTYSKRRNGLIKKAKEISVLCDAQVSVIIFGSSGKMHEYCS 59
                      79***********************************************96 PP

2K-box88.81e-2971168198
             K-box   1 yqkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenka 93 
                       y+++ gk+l++ak+e+l++el+++kke++nLq ++Rhl+Ged++sL+++eL  Le+ Le++l  +R++K+e+l+++ +++++ e++++e + +
  Eucgr.E01006.1.p  71 YHTQCGKRLWDAKQENLSNELDRIKKENDNLQIQLRHLKGEDITSLNHRELIILEDTLENGLGCVRDQKDEVLMTHRRNQKQLEEDAKELHFY 163
                       78889999************************************************************************************9 PP

             K-box  94 Lrkkl 98 
                        ++k 
  Eucgr.E01006.1.p 164 AQQKD 168
                       99985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006631.861161IPR002100Transcription factor, MADS-box
SMARTSM004326.6E-41160IPR002100Transcription factor, MADS-box
CDDcd002652.07E-40280No hitNo description
SuperFamilySSF554552.09E-35296IPR002100Transcription factor, MADS-box
PRINTSPR004046.9E-29323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003192.4E-241057IPR002100Transcription factor, MADS-box
PRINTSPR004046.9E-292338IPR002100Transcription factor, MADS-box
PRINTSPR004046.9E-293859IPR002100Transcription factor, MADS-box
PfamPF014862.1E-1782161IPR002487Transcription factor, K-box
PROSITE profilePS5129714.44684173IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010093Biological Processspecification of floral organ identity
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 209 aa     Download sequence    Send to blast
MGRGKIEIKR IENSNNRQVT YSKRRNGLIK KAKEISVLCD AQVSVIIFGS SGKMHEYCSS  60
NTSLVDILDQ YHTQCGKRLW DAKQENLSNE LDRIKKENDN LQIQLRHLKG EDITSLNHRE  120
LIILEDTLEN GLGCVRDQKD EVLMTHRRNQ KQLEEDAKEL HFYAQQKDMM MAETGRAGND  180
GYHQRMKADF GPSTYHVQPI QPNLQRRF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_A2e-17261160MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B2e-17261160MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C2e-17261160MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_D2e-17261160MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1tqe_P4e-17161161Myocyte-specific enhancer factor 2B
1tqe_Q4e-17161161Myocyte-specific enhancer factor 2B
1tqe_R4e-17161161Myocyte-specific enhancer factor 2B
1tqe_S4e-17161161Myocyte-specific enhancer factor 2B
3kov_I4e-17261160Myocyte-specific enhancer factor 2A
3kov_J4e-17261160Myocyte-specific enhancer factor 2A
3mu6_A2e-17261160Myocyte-specific enhancer factor 2A
3mu6_B2e-17261160Myocyte-specific enhancer factor 2A
3mu6_C2e-17261160Myocyte-specific enhancer factor 2A
3mu6_D2e-17261160Myocyte-specific enhancer factor 2A
3p57_A4e-17261160Myocyte-specific enhancer factor 2A
3p57_B4e-17261160Myocyte-specific enhancer factor 2A
3p57_C4e-17261160Myocyte-specific enhancer factor 2A
3p57_D4e-17261160Myocyte-specific enhancer factor 2A
3p57_I4e-17261160Myocyte-specific enhancer factor 2A
3p57_J4e-17261160Myocyte-specific enhancer factor 2A
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00080ChIP-seqTransfer from AT5G20240Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.E01006.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF0299760.0AF029976.1 Eucalyptus grandis MADS box protein (EGM2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001289656.11e-155floral homeotic protein GLOBOSA-like
SwissprotQ074747e-89MADS2_PETHY; Floral homeotic protein PMADS 2
TrEMBLA0A059C2S91e-155A0A059C2S9_EUCGR; Uncharacterized protein
STRINGVIT_18s0001g01760.t012e-92(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM53002751
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G20240.12e-82MIKC_MADS family protein